PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010546427.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 276aa    MW: 30240.1 Da    PI: 10.0728
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010546427.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.2e-1497142247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT eE+  ++ + k+lG  +W+ I++++ ++Rt+ q+ s+ qky
   XP_010546427.1  97 KPWTVEEHRTFLAGLKKLGRSNWSDISKKFVTTRTPAQVASHAQKY 142
                      58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.92491147IPR017930Myb domain
SuperFamilySSF466892.44E-1593147IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-1594146IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.6E-1195141IPR009057Homeodomain-like
SMARTSM007172.7E-1195145IPR001005SANT/Myb domain
PfamPF002492.4E-1197142IPR001005SANT/Myb domain
CDDcd001672.95E-998143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
SGHNRHNART CVNDVNKPCV KLFGVNISDP KPNVTALRKS VSLGNLQSLP GNAAAAAAED  60
SSLAGNAAAA VEDSGYLSDS LISSKKRKAA HEKKKGKPWT VEEHRTFLAG LKKLGRSNWS  120
DISKKFVTTR TPAQVASHAQ KYFIRQNING NRKRRASLFD MPLNDHEEDD SPQQPSTDAP  180
APSKTLAETD TTPSVKPTIL PREPVQDIAR YDILNPFQNL SMEYGRIYQT IPHDYYAPPY  240
LVFPQMFHSA KAGGFQTVHP SGIPAPRHIP TGMPPP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010546427.10.0PREDICTED: transcription factor MYB1R1-like, partial
TrEMBLD7MV432e-90D7MV43_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.8__2146__AT5G61620.15e-90(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-75MYB_related family protein